HORDB

ID: hor004636
Uniprot ID: Q3E9I4
Protein name: CLAVATA3/ESR (CLE)-related protein 22
Gene name: CLE22
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE22p]: Mostly expressed in stems and apex, and, to a lower extent, in seedlings, leaves, flowers and siliques.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010087 phloem or xylem histogenesis; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0048364 root development; GO:0048731 system development
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: SSSSPNIHHHSTHGSLKKSGNLDPKLHDLDSNAASSRGSKYTNYEGGGEDVFEDGKRRVFTGPNPLHNR
Length: 69(35-103)
Propeptide: MGNYYSRRKSRKHITTVALIILLLLLFLFLYAKASSSSPNIHHHSTHGSLKKSGNLDPKLHDLDSNAASSRGSKYTNYEGGGEDVFEDGKRRVFTGPNPLHNR
Signal peptide: MGNYYSRRKSRKHITTVALIILLLLLFLFLYAKA
Modification: T63 Hydroxyproline
Glycosylation: T63 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004636_AF2.pdb

hor004636_ESM.pdb

Mass:	871308	Formula:	C318H492N104O108
Absent amino acids:	CMQW	Common amino acids:	S
pI:	9.08	Basic residues:	15
Polar residues:	30	Hydrophobic residues:	12
Hydrophobicity:	-127.1	Boman Index:	-20995
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	45.22
Instability Index:	5184.78	Extinction Coefficient cystines:	2980
Absorbance 280nm:	43.82